filenames -i INODES Number of inodes for the filesystem -l FILE Read bad blocks list from FILE -v Make version 2 filesystem[-v] [-n LABEL] BLOCKDEV [KBYTES] Make a FAT32 filesystem Options: -v Verbose -n LBL Volume label[-m MODE] NAME TYPE MAJOR MINOR Create a special file (block, character, or pipe) Options: -m MODE Creation mode (default a=rw) TYPE: b Block device c or u Character device p Named pipe (MAJOR and MINOR are ignored)[OPTIONS] [PASSWORD] [SALT] Crypt the PASSWORD using crypt(3) Options: -P,--password-fd=N Read password from fd N -m,--method=TYPE Encryption method TYPE -S,--salt=SALT[-L LBL] BLOCKDEV [KBYTES] Prepare BLOCKDEV to be used as swap partition Options: -L LBL Label[-dt] [-p DIR] [TEMPLATE] Create a temporary file with name based on TEMPLATE and print its name. TEMPLATE must end with XXXXXX (e.g. [/dir/]nameXXXXXX). Options: -d Make a directory instead of a file -t Generate a path rooted in temporary directory -p DIR Use DIR as a temporary directory (implies -t) For -t or -p, directory is chosen as follows: $TMPDIR if set, else -p DIR, else /tmp[-adlp0] [-F keyword] MODULE Options: -a Shortcut for '-F author' -d Shortcut for '-F description' -l Shortcut for '-F license' -p Shortcut for '-F parm' -F keyword Keyword to look for -0 Separate output with NULs[-qfwrsv] MODULE [symbol=value]... Options: -r Remove MODULE (stacks) or do autoclean -q Quiet -v Verbose -f Force -w Wait for unload -s Report via syslog instead of stderr[FILE]... View FILE (or stdin) one screenful at a time[OPTIONS] [-o OPTS] DEVICE NODE Mount a filesystem. Filesystem autodetection requires /proc. Options: -a Mount all filesystems in fstab -f Dry run -r Read-only mount -w Read-write mount (default) -t FSTYPE Filesystem type -O OPT Mount only filesystems with option OPT (-a only) -o OPT: loop Ignored (loop devices are autodetected) [a]sync Writes are [a]synchronous [no]atime Disable/enable updates to inode access times [no]diratime Disable/enable atime updates to directories [no]relatime Disable/enable atime updates relative to modification time [no]dev (Dis)allow use of special device files [no]exec (Dis)allow use of executable files [no]suid (Dis)allow set-user-id-root programs [r]shared Convert [recursively] to a shared subtree [r]slave Convert [recursively] to a slave subtree [r]private Convert [recursively] to a private subtree [un]bindable Make mount point [un]able to be bind mounted bind Bind a file or directory to another location move Relocate an existing mount point remount Remount a mounted filesystem, changing flags ro/rw Same as -r/-w There are filesystem-specific -o flags.[-q] <[-dn] DIR | -x DEVICE> Check if the directory is a mountpoint Options: -q Quiet -d Print major/minor device number of the filesystem -n Print device name of the filesystem -x Print major/minor device number of the blockdevice[-A] [-I SUM|CPU|ALL|SCPU] [-u] [-P num|ALL] [INTERVAL [COUNT]] Per-processor statistics Options: -A Same as -I ALL -u -P ALL -I SUM|CPU|ALL|SCPU Report interrupt statistics -P num|ALL Processor to monitor -u Report CPU utilization[-f device] opcode value Control magnetic tape drive operation Available Opcodes: bsf bsfm bsr bss datacompression drvbuffer eof eom erase fsf fsfm fsr fss load lock mkpart nop offline ras1 ras2 ras3 reset retension rewind rewoffline seek setblk setdensity setpart tell unload unlock weof wset[-fin] SOURCE DEST or: mv [-fin] SOURCE... DIRECTORY Rename SOURCE to DEST, or move SOURCE(s) to DIRECTORY Options: -f Don't prompt before overwriting -i Interactive, prompt before overwrite -n Don't overwrite an existing file[-s] [-c FILE] [{IFNAME MACADDR}] Rename network interface while it in the down state Options: -c FILE Use configuration file (default: /etc/mactab) -s Use syslog (LOCAL0 facility) IFNAME MACADDR new_interface_name interface_mac_addressHOST PORT BLOCKDEV Connect to HOST and provide a network block device on BLOCKDEV[-iN] [-wN] [-l] [-p PORT] [-f FILE|IPADDR PORT] [-e PROG] Open a pipe to IP:PORT or FILE Options: -e PROG Run PROG after connect -l Listen mode, for inbound connects (use -l twice with -e for persistent server) -p PORT Local port -w SEC Timeout for connect -i SEC Delay interval for lines sent -f FILE Use file (ala /dev/ttyS0) instead of network[-ral] [-tuwx] [-enWp] Display networking information Options: -r Routing table -a All sockets -l Listening sockets Else: connected sockets -t TCP sockets -u UDP sockets -w Raw sockets -x Unix sockets Else: all socket types -e Other/more information -n Don't resolve names -W Wide display -p Show PID/program name for sockets[-n ADJUST] [PROG ARGS] Change scheduling priority, run PROG Options: -n ADJUST Adjust priority by ADJUSTformat_string Monitor system in real time Format specifiers: %Nc or %[cN] Monitor CPU. N - bar size, default 10 (displays: S:system U:user N:niced D:iowait I:irq i:softirq) %[niface] Monitor network interface 'iface' %m Monitor allocated memory %[mf] Monitor free memory %[mt] Monitor total memory %s Monitor allocated swap %f Monitor number of used file descriptors %Ni Monitor total/specific IRQ rate %x Monitor context switch rate %p Monitor forks %[pn] Monitor # of processes %b Monitor block io %Nt Show time (with N decimal points) %Nd Milliseconds between updates (default:1000) %r Print instead of at EOLPROG ARGS Run PROG immune to hangups, with output to a non-tty[HOST] [SERVER] Query the nameserver for the IP address of the given HOST optionally using a specified DNS server[-dnqNwl] [-S PROG] [-p PEER]... NTP client/server Options: -d Verbose -n Do not daemonize -q Quit after clock is set -N Run at high priority -w Do not set time (only query peers), implies -n -l Run as server on port 123 -S PROG Run PROG after stepping time, stratum change, and every 11 mins -p PEER Obtain time from PEER (may be repeated)[-aBbcDdeFfHhIiLlOovXx] [-t TYPE] [FILE] Write an unambiguous representation, octal bytes by default, of FILE (or stdin) to stdout[-c N] [-sw] [PROG ARGS] Start PROG on a new virtual terminal Options: -c N Use specified VT -s Switch to the VT -w Wait for PROG to exit[OPTIONS] [USER] Change USER's password. If no USER is specified, changes the password for the current user. Options: -a ALG Algorithm to use for password (des, md5) -d Delete password for the account -l Lock (disable) account -u Unlock (re-enable) account[OPTIONS] [ORIGFILE [PATCHFILE]] -p,--strip N Strip N leading components from file names -i,--input DIFF Read DIFF instead of stdin -R,--reverse Reverse patch -N,--forward Ignore already applied patches --dry-run Don't actually change files -E,--remove-empty-files Remove output files if they become empty[-flnovx] [-s SID|-P PPID|PATTERN] Display process(es) selected by regex PATTERN Options: -l Show command name too -f Match against entire command line -n Show the newest process only -o Show the oldest process only -v Negate the match -x Match whole name (not substring) -s Match session ID (0 for current) -P Match parent process ID[OPTIONS] [NAME]... List PIDs of all processes with names that match NAMEs Options: -s Show only one PID -o PID Omit given pid Use %PPID to omit pid of pidof's parent[OPTIONS] HOST Send ICMP ECHO_REQUEST packets to network hosts Options: -4,-6 Force IP or IPv6 name resolution -c CNT Send only CNT pings -s SIZE Send SIZE data bytes in packets (default:56) -I IFACE/IP Use interface or IP address as source -W SEC Seconds to wait for the first response (default:10) (after all -c CNT packets are sent) -w SEC Seconds until ping exits (default:infinite) (can exit earlier with -c CNT) -q Quiet, only displays output at start and when finishedNEW_ROOT PUT_OLD Move the current root file system to PUT_OLD and make NEW_ROOT the new root file system[-l|-SIGNAL] [-fnovx] [-s SID|-P PPID|PATTERN] Send a signal to process(es) selected by regex PATTERN Options: -l List all signals -f Match against entire command line -n Signal the newest process only -o Signal the oldest process only -v Negate the match -x Match whole name (not substring) -s Match session ID (0 for current) -P Match parent process ID[-x][-q] PID Display detailed precesses' memory usage Options: -x show details -q quiet[OPTIONS] MAILDIR [CONN_HELPER ARGS] Fetch content of remote mailbox to local maildir Options: -s Skip authorization -T Get messages with TOP instead of RETR -k Keep retrieved messages on the server -t SEC Network timeout -F "PROG ARGS" Filter program (may be repeated) -M "PROG ARGS" Delivery program Fetch from plain POP3 server: popmaildir -k DIR nc pop3.server.com 110 after signal is processedFILE Receive a file using the xmodem protocol[-afqt] [-c PROG] [OUTFILE] Options: -a Append output -c PROG Run PROG, not shell -f Flush output after each write -q Quiet -t Send timing to stderrtimingfile [typescript [divisor]] Play back typescripts, using timing information[-efinr] SED_CMD [FILE]... Options: -e CMD Add CMD to sed commands to be executed -f FILE Add FILE contents to sed commands to be executed -i Edit files in-place (else sends result to stdout) -n Suppress automatic printing of pattern space -r Use extended regex syntax If no -e or -f, the first non-option argument is the sed command string. Remaining arguments are input files (stdin if none).[OPTIONS] [RECIPIENT_EMAIL]... Read email from stdin and send it Standard options: -t Read additional recipients from message body -f sender Sender (required) -o options Various options. -oi implied, others are ignored -i -oi synonym. implied and ignored Busybox specific options: -w seconds Network timeout -H 'PROG ARGS' Run connection helper Examples: -H 'exec openssl s_client -quiet -tls1 -starttls smtp -connect smtp.gmail.com:25' -ap] -H 'exec openssl s_client -quiet -tls1 -connect smtp.gmail.com:465' -ap] -S server[:port] Server -au Username for AUTH LOGIN -ap Password for AUTH LOGIN -am Authentication method. Ignored. LOGIN is implied Other options are silently ignored; -oi -t is implied Use makemime applet to create message with attachments[-w] [-s SEP] [FIRST [INC]] LAST Print numbers from FIRST to LAST, in steps of INC. FIRST, INC default to 1. Options: -w Pad to last with leading zeros -s SEP String separatorpersonality PROG ARGS Personality may be: linux32 Set 32bit uname emulation linux64 Set 64bit uname emulation[-r|--reset] [DEVICE] Redirect system console output to DEVICE (default: /dev/tty) Options: -r Reset output to /dev/consoleFONT [-m MAPFILE] [-C TTY] Load a console font Options: -m MAPFILE Load console screen map -C TTY Affect TTY instead of /dev/ttySCANCODE KEYCODE... Set entries into the kernel's scancode-to-keycode map, allowing unusual keyboards to generate usable keycodes. SCANCODE may be either xx or e0xx (hexadecimal), and KEYCODE is given in decimal.N Redirect the kernel output to console N (0 for current)PROG ARGS Run PROG in a new session. PROG will have no controlling terminal and will not be affected by keyboard signals (Ctrl-C etc). See setsid(2) for details.USER PROG ARGS Set uid and gid to USER's uid and gid, drop supplementary group ids, run PROG[FILE]... or: sha1sum -c [-sw] [FILE] Print or check SHA1 checksums Options: -c Check sums against given list -s Don't output anything, status code shows success -w Warn about improperly formatted checksum lines[FILE]... or: sha256sum -c [-sw] [FILE] Print or check SHA256 checksums Options: -c Check sums against given list -s Don't output anything, status code shows success -w Warn about improperly formatted checksum lines[FILE]... or: sha512sum -c [-sw] [FILE] Print or check SHA512 checksums Options: -c Check sums against given list -s Don't output anything, status code shows success -w Warn about improperly formatted checksum lines[-a | -k | -s] Show keys pressed Options: -a Display decimal/octal/hex values of the keys -k Display interpreted keycodes (default) -s Display raw scan-codes[-cehmLF] [-s SPEED] [-p PROTOCOL] DEVICE Attach network interface(s) to serial line(s) Options: -p PROT Set protocol (slip, cslip, slip6, clisp6 or adaptive) -s SPD Set line speed -e Exit after initializing device -h Exit when the carrier is lost -c PROG Run PROG when the line is hung up -m Do NOT initialize the line in raw 8 bits mode -L Enable 3-wire operation -F Disable RTS/CTS flow control[N]... Pause for a time equal to the total of the args given, where each arg can have an optional suffix of (s)econds, (m)inutes, (h)ours, or (d)ays>SMEMDATA.TAR Collect memory usage data in /proc and write it to stdout[-a BYTES] [-m BYTES] [-d BYTES] [-s BYTES] [-l BYTES] [-f BYTES] [-c BYTES] [-r BYTES] [-o N] [-p N] [-t N] PROG ARGS Set soft resource limits, then run PROG Options: -a BYTES Limit total size of all segments -m BYTES Same as -d BYTES -s BYTES -l BYTES -a BYTES -d BYTES Limit data segment -s BYTES Limit stack segment -l BYTES Limit locked memory size -o N Limit number of open files per process -p N Limit number of processes per uid Options controlling file sizes: -f BYTES Limit output file sizes -c BYTES Limit core file size Efficiency opts: -r BYTES Limit resident set size -t N Limit CPU time, process receives a SIGXCPU after N seconds[-nrugMcszbdfimSTokt] [-o FILE] [-k start[.offset][opts][,end[.offset][opts]] [-t CHAR] [FILE]... Sort lines of text Options: -b Ignore leading blanks -c Check whether input is sorted -d Dictionary order (blank or alphanumeric only) -f Ignore case -g General numerical sort -i Ignore unprintable characters -k Sort key -M Sort month -n Sort numbers -o Output to file -k Sort by key -t CHAR Key separator -r Reverse sort order -s Stable (don't sort ties alphabetically) -u Suppress duplicate lines -z Lines are terminated by NUL, not newline -mST Ignored for GNU compatibility[OPTIONS] [INPUT [PREFIX]] Options: -b N[k|m] Split by N (kilo|mega)bytes -l N Split by N lines -a N Use N letters as suffix[OPTIONS] [-S|-K] ... [-- ARGS...] Search for matching processes, and then -K: stop all matching processes. -S: start a process unless a matching process is found. Process matching: -u,--user USERNAME|UID Match only this user's processes -n,--name NAME Match processes with NAME in comm field in /proc/PID/stat -x,--exec EXECUTABLE Match processes with this command in /proc/PID/cmdline -p,--pidfile FILE Match a process with PID from the file All specified conditions must match -S only: -x,--exec EXECUTABLE Program to run -a,--startas NAME Zeroth argument -b,--background Background -N,--nicelevel N Change nice level -c,--chuid USER[:[GRP]] Change to user/group -m,--make-pidfile Write PID to the pidfile specified by -p -K only: -s,--signal SIG Signal to send -t,--test Match only, exit with 0 if a process is found Other: -o,--oknodo Exit with status 0 if nothing is done -v,--verbose Verbose -q,--quiet Quiet[OPTIONS] FILE... Display file (default) or filesystem status Options: -c fmt Use the specified format -f Display filesystem status -L Follow links -t Display info in terse form Valid format sequences for files: %a Access rights in octal %A Access rights in human readable form %b Number of blocks allocated (see %B) %B The size in bytes of each block reported by %b %d Device number in decimal %D Device number in hex %f Raw mode in hex %F File type %g Group ID of owner %G Group name of owner %h Number of hard links %i Inode number %n File name %N File name, with -> TARGET if symlink %o I/O block size %s Total size, in bytes %t Major device type in hex %T Minor device type in hex %u User ID of owner %U User name of owner %x Time of last access %X Time of last access as seconds since Epoch %y Time of last modification %Y Time of last modification as seconds since Epoch %z Time of last change %Z Time of last change as seconds since Epoch Valid format sequences for file systems: %a Free blocks available to non-superuser %b Total data blocks in file system %c Total file nodes in file system %d Free file nodes in file system %f Free blocks in file system %i File System ID in hex %l Maximum length of filenames %n File name %s Block size (for faster transfer) %S Fundamental block size (for block counts) %t Type in hex %T Type in human readable form[-afo] [-n LEN] [FILE]... Display printable strings in a binary file Options: -a Scan whole file (default) -f Precede strings with filenames -n LEN At least LEN characters form a string (default 4) -o Precede strings with decimal offsets[-a|g] [-F DEVICE] [SETTING]... Without arguments, prints baud rate, line discipline, and deviations from stty sane Options: -F DEVICE Open device instead of stdin -a Print all current settings in human-readable form -g Print in stty-readable form [SETTING] See manpage[OPTIONS] [-] [USERNAME] Change user id or become root Options: -p,-m Preserve environment -c CMD Command to pass to 'sh -c' -s SH Shell to use instead of default shell[-t N] [TTY] Single user login Options: -t N Timeout[-rs] [FILE]... Checksum and count the blocks in a file Options: -r Use BSD sum algorithm (1K blocks) -s Use System V sum algorithm (512byte blocks)[-v] [-w SEC] CMD SERVICE_DIR... Control services monitored by runsv supervisor. Commands (only first character is enough): status: query service status up: if service isn't running, start it. If service stops, restart it once: like 'up', but if service stops, don't restart it down: send TERM and CONT signals. If ./run exits, start ./finish if it exists. After it stops, don't restart service exit: send TERM and CONT signals to service and log service. If they exit, runsv exits too pause, cont, hup, alarm, interrupt, quit, 1, 2, term, kill: send STOP, CONT, HUP, ALRM, INT, QUIT, USR1, USR2, TERM, KILL signal to service[-ttv] [-r C] [-R CHARS] [-l MATCHLEN] [-b BUFLEN] DIR... Continuously read log data from stdin, optionally filter log messages, and write the data to one or more automatically rotated logs[-a] [DEVICE] Stop swapping on DEVICE Options: -a Stop swapping on all swap devices[-a] [-p PRI] [DEVICE] Start swapping on DEVICE Options: -a Start swapping on all swap devices -p PRI Set swap device priority[-c /dev/console] NEW_ROOT NEW_INIT [ARGS] Free initramfs and switch to another root fs: chroot to NEW_ROOT, delete all in /, move NEW_ROOT to /, execute NEW_INIT. PID must be 1. NEW_ROOT must be a mountpoint. Options: -c DEV Reopen stdio to DEV after switch Write all buffered blocks to disk[OPTIONS] [VALUE]... Configure kernel parameters at runtime Options: -n Don't print key names -e Don't warn about unknown keys -w Change sysctl setting -p FILE Load sysctl settings from FILE (default /etc/sysctl.conf) -a Display all values -A Display all values in table form[OPTIONS] System logging utility. This version of syslogd ignores /etc/syslog.conf Options: -n Run in foreground -O FILE Log to given file (default:/var/log/messages) -l N Set local log level -S Smaller logging output -s SIZE Max size (KB) before rotate (default:200KB, 0=off) -b N N rotated logs to keep (default:1, max=99, 0=purge) -R HOST[:PORT] Log to IP or hostname on PORT (default PORT=514/UDP) -L Log locally and via network (default is network only if -R) -D Drop duplicates -C[size(KiB)] Log to shared mem buffer (read it using logread)[FILE]... Concatenate FILEs and print them in reverse[OPTIONS] [FILE]... Print last 10 lines of each FILE (or stdin) to stdout. With more than one FILE, precede each with a filename header. Options: -f Print data as file grows -s SECONDS Wait SECONDS between reads with -f -n N[kbm] Print last N lines -c N[kbm] Print last N bytes -q Never print headers -v Always print headers N may be suffixed by k (x1024), b (x512), or m (x1024^2). If N starts with a '+', output begins with the Nth item from the start of each file, not from the end.-[cxtzjamvO] [-X FILE] [-f TARFILE] [-C DIR] [FILE]... Create, extract, or list files from a tar file Operation: c Create x Extract t List Options: f Name of TARFILE ('-' for stdin/out) C Change to DIR before operation v Verbose z (De)compress using gzip j (De)compress using bzip2 a (De)compress using lzma O Extract to stdout h Follow symlinks m Don't restore mtime exclude File to exclude X File with names to exclude T File with names to include[-hEv] [-c N] [-C N[:MSG]] [-b N] [-u USER] [-l NAME] IP PORT PROG Create TCP socket, bind to IP:PORT and listen for incoming connection. Run PROG for each connection. IP IP to listen on. '0' = all PORT Port to listen on PROG ARGS Program to run -l NAME Local hostname (else looks up local hostname in DNS) -u USER[:GRP] Change to user/group after bind -c N Handle up to N connections simultaneously -b N Allow a backlog of approximately N TCP SYNs -C N[:MSG] Allow only up to N connections from the same IP. New connections from this IP address are closed immediately. MSG is written to the peer before close -h Look up peer's hostname -E Don't set up environment variables -v Verbose[-ai] [FILE]... Copy stdin to each FILE, and also to stdout Options: -a Append to the given FILEs, don't overwrite -i Ignore interrupt signals (SIGINT)[-a] [-l USER] HOST [PORT] Connect to telnet server Options: -a Automatic login with $USER variable -l USER Automatic login as USER[OPTIONS] Handle incoming telnet connections Options: -l LOGIN Exec LOGIN on connect -f ISSUE_FILE Display ISSUE_FILE instead of /etc/issue -K Close connection as soon as login exits (normally wait until all programs close slave pty) -p PORT Port to listen on -b ADDR[:PORT] Address to bind to -F Run in foreground -i Inetd mode -w SEC Inetd 'wait' mode, linger time SEC -S Log to syslog (implied by -i or without -F and -w)EXPRESSION ] Check file types, compare values etc. Return a 0/1 exit code depending on logical value of EXPRESSION[OPTIONS] HOST [PORT] Transfer a file from/to tftp server Options: -l FILE Local FILE -r FILE Remote FILE -g Get file -p Put file -b SIZE Transfer blocks of SIZE octets[-cr] [-u USER] [DIR] Transfer a file on tftp client's request tftpd should be used as an inetd service. tftpd's line for inetd.conf: 69 dgram udp nowait root tftpd tftpd /files/to/serve It also can be ran from udpsvd: udpsvd -vE 0.0.0.0 69 tftpd /files/to/serve Options: -r Prohibit upload -c Allow file creation via upload -u Access files as USER[-v] PROG ARGS Run PROG, display resource usage when it exits Options: -v Verbose[-t SECS] [-s SIG] PROG ARGS Runs PROG. Sends SIG to it if it is not gone in SECS seconds. Defaults: SECS: 10, SIG: TERM.[-b] [-nCOUNT] [-dSECONDS] [-m] Provide a view of process activity in real time. Read the status of all processes from /proc each SECONDS and display a screenful of them.[-c] [-d DATE] [-r FILE] FILE [FILE]... Update the last-modified date on the given FILE[s] Options: -c Don't create files -d DT Date/time to use -r FILE Use FILE's date/time[-cds] STRING1 [STRING2] Translate, squeeze, or delete characters from stdin, writing to stdout Options: -c Take complement of STRING1 -d Delete input characters coded STRING1 -s Squeeze multiple output characters of STRING2 into one character[-FIldnrv] [-f 1ST_TTL] [-m MAXTTL] [-p PORT] [-q PROBES] [-s SRC_IP] [-t TOS] [-w WAIT_SEC] [-g GATEWAY] [-i IFACE] [-z PAUSE_MSEC] HOST [BYTES] Trace the route to HOST Options: -F Set the don't fragment bit -I Use ICMP ECHO instead of UDP datagrams -l Display the TTL value of the returned packet -d Set SO_DEBUG options to socket -n Print numeric addresses -r Bypass routing tables, send directly to HOST -v Verbose -m Max time-to-live (max number of hops) -p Base UDP port number used in probes (default 33434) -q Number of probes per TTL (default 3) -s IP address to use as the source address -t Type-of-service in probe packets (default 0) -w Time in seconds to wait for a response (default 3) -g Loose source route gateway (8 max) Return an exit code of TRUE (0) Print file name of stdin's terminal Options: -s Print nothing, only return exit status[w] [h] Print dimension(s) of stdin's terminal, on error return 80x25[-f device] ([-t name] | -d name) [-u owner] [-g group] [-b] Create or delete tun interfaces Options: -f name tun device (/dev/net/tun) -t name Create iface 'name' -d name Delete iface 'name' -u owner Set iface owner -g group Set iface group -b Brief output[-fbnqvoCR] [-i IFACE] [-r IP] [-s PROG] [-p PIDFILE] [-H HOSTNAME] [-V VENDOR] [-x OPT:VAL]... [-O OPT]... [-P N] -i,--interface IFACE Interface to use (default eth0) -p,--pidfile FILE Create pidfile -s,--script PROG Run PROG at DHCP events (default /usr/share/udhcpc/default.script) -t,--retries N Send up to N discover packets -T,--timeout N Pause between packets (default 3 seconds) -A,--tryagain N Wait N seconds after failure (default 20) -f,--foreground Run in foreground -b,--background Background if lease is not obtained -n,--now Exit if lease is not obtained -q,--quit Exit after obtaining lease -R,--release Release IP on exit -S,--syslog Log to syslog too -P,--client-port N Use port N (default 68) -a,--arping Use arping to validate offered address -O,--request-option OPT Request option OPT from server (cumulative) -o,--no-default-options Don't request any options (unless -O is given) -r,--request IP Request this IP address -x OPT:VAL Include option OPT in sent packets (cumulative) Examples of string, numeric, and hex byte opts: -x hostname:bbox - option 12 -x lease:3600 - option 51 (lease time) -x 0x3d:0100BEEFC0FFEE - option 61 (client id) -F,--fqdn NAME Ask server to update DNS mapping for NAME -H,-h,--hostname NAME Send NAME as client hostname (default none) -V,--vendorclass VENDOR Vendor identifier (default 'udhcp VERSION') -C,--clientid-none Don't send MAC as client identifier -v Verbose[-fS] [-P N] [CONFFILE] DHCP server -f Run in foreground -S Log to syslog too -P N Use port N (default 67)[-hEv] [-c N] [-u USER] [-l NAME] IP PORT PROG Create UDP socket, bind to IP:PORT and wait for incoming packets. Run PROG for each packet, redirecting all further packets with same peer ip:port to it. IP IP to listen on. '0' = all PORT Port to listen on PROG ARGS Program to run -l NAME Local hostname (else looks up local hostname in DNS) -u USER[:GRP] Change to user/group after bind -c N Handle up to N connections simultaneously -h Look up peer's hostname -E Don't set up environment variables -v Verbose[OPTIONS] FILESYSTEM|DIRECTORY Unmount file systems Options: -a Unmount all file systems -r Try to remount devices as read-only if mount is busy -l Lazy umount (detach filesystem) -f Force umount (i.e., unreachable NFS server) -d Free loop device if it has been used[-amnrspv] Print system information Options: -a Print all -m The machine (hardware) type -n Hostname -r OS release -s OS name (default) -p Processor type -v OS version[-fa][-t N] [FILE]... Convert spaces to tabs, writing to stdout Options: -a,--all Convert all blanks -f,--first-only Convert only leading blanks -t,--tabs=N Tabstops every N chars[-cdu][-f,s,w N] [INPUT [OUTPUT]] Discard duplicate lines Options: -c Prefix lines by the number of occurrences -d Only print duplicate lines -u Only print unique lines -f N Skip first N fields -s N Skip first N chars (after any skipped fields) -w N Compare N characters in line[-ud] [FILE] Convert FILE in-place from Unix to DOS format. When no file is given, use stdin/stdout. Options: -u dos2unix -d unix2dos[-cf] [FILE]... Decompress FILE (or stdin) Options: -c Write to stdout -f Force[-cfvCF] [FILE]... Options: -c Write to stdout -f Force -v Verbose -F Don't store or verify checksum[-cf] [FILE]... Decompress FILE (or stdin) Options: -c Write to stdout -f Force[-opts[modifiers]] FILE[.zip] [LIST] [-x XLIST] [-d DIR] Extract files from ZIP archives Options: -l List archive contents (with -q for short form) -n Never overwrite files (default) -o Overwrite -p Send output to stdout -q Quiet -x XLST Exclude these files -d DIR Extract files into DIR Display the time since the last bootN Pause for N microseconds[-o OUTFILE] [INFILE] Uudecode a file Finds outfile name in uuencoded source unless -o is given[-m] [INFILE] STORED_FILENAME Uuencode a file to stdout Options: -m Use base64 encoding per RFC1521COMMAND [OPTIONS] Create and remove virtual ethernet devices Options: add [interface-name] [vlan_id] rem [vlan-name] set_flag [interface-name] [flag-num] [0 | 1] set_egress_map [vlan-name] [skb_priority] [vlan_qos] set_ingress_map [vlan-name] [skb_priority] [vlan_qos] set_name_type [name-type][OPTIONS] [FILE]... Edit FILE Options: -c Initial command to run ($EXINIT also available) -R Read-only -H Short help regarding available features[-a] Lock a virtual terminal. A password is required to unlock. Options: -a Lock all VTs[DEVICE] Show CD volume name of the DEVICE (default /dev/cdrom)[FILE] Write content of FILE or stdin to all logged-in users[-n SEC] [-t] PROG ARGS Run PROG periodically Options: -n Loop period in seconds (default 2) -t Don't print header[-t N[ms]] [-T N[ms]] [-F] DEV Periodically write to watchdog device DEV Options: -T N Reboot after N seconds if not reset (default 60) -t N Reset every N seconds (default 30) -F Run in foreground Use 500ms to specify period in milliseconds[-cmlwL] [FILE]... Count lines, words, and bytes for each FILE (or stdin) Options: -c Count bytes -m Count characters -l Count newlines -w Count words -L Print longest line length[-c|--continue] [-s|--spider] [-q|--quiet] [-O|--output-document FILE] [--header 'header: value'] [-Y|--proxy on/off] [-P DIR] [--no-check-certificate] [-U|--user-agent AGENT][-T SEC] URL Retrieve files via HTTP or FTP Options: -s Spider mode - only check file existence -c Continue retrieval of aborted transfer -q Quiet -P DIR Save to DIR (default .) -T SEC Network read timeout is SEC seconds -O FILE Save to FILE ('-' for stdout) -U STR Use STR for User-Agent header -Y Use proxy ('on' or 'off')[COMMAND]... Locate a COMMAND[-a] Show who is logged on Options: -a Show all Print the user name associated with the current effective user id[OPTIONS] [PROG ARGS] Run PROG on every item given by stdin Options: -p Ask user whether to run each command -r Don't run command if input is empty -0 Input is separated by NUL characters -t Print the command on stderr before execution -e[STR] STR stops input processing -n N Pass no more than N args to PROG -s N Pass command line of no more than N bytes -x Exit if size is exceeded-d [-cf] [FILE]... Decompress FILE (or stdin) Options: -d Decompress -c Write to stdout -f ForceFILE Decompress to stdout[STRING] Repeatedly output a line with STRING, or 'y'FILE Decompress to stdout[OPTIONS] IFACE SCRIPT Manage a ZeroConf IPv4 link-local address Options: -f Run in foreground -q Quit after obtaining address -r 169.254.x.x Request this address first -v Verbose With no -q, runs continuously monitoring for ARP conflicts, exits only on I/O errors (link down etc)/usr/bin//usr/sbin/BusyBox v1.18.3 (2012-01-11 21:43:37 CET)memory exhaustedinvalid date '%s'(unknown)can't create raw socketpermission denied (are you root?)you must be root%s requires an argumentinvalid argument '%s' to '%s'standard inputstandard output0123456789ABCDEF/proc/self/exe-/bin/shPATH=/sbin:/usr/sbin:/bin:/usr/bin/var/log/wtmp/dev/LINESCOLUMNScan't open '%s'close failed/dev/urandomSELinux support is disabledcan't stat '%s'sendtolistencan't change root directory to %ssetuidsetgid%s: I/O errorcan't create temp file '%s'lseek(%lu)lseekshort writecan't duplicate file descriptorcan't create pipecan't move '%s' to '%s'can't remove file '%s'not a symlink%s: cannot read link: %sshort read%u.%u.%u-%u:%u%c%u-%u-%u %u:%u%c%b %d %T %Y%2u%2u%2u%2u%2u%c%4u%2u%2u%2u%2u%c/etc/group/etc/passwd/etc/shadow   /etc/shells%s.tmp%s: write error -1:?2:g+g:S/etc/gshadow%s '%s' in useno %cids leftx:%u:!::gidgsystemSLinux User,,,=1:SD:u+h:g:s:G:DSHu:/home/%snogroup/bin/falsex:%u:%u:%s:%s:%s!:%u:0:99999:7:::addgroup '%s' '%s'addgroup -g %u '%s'%u:%uchown/etc/skelcan't execute passwd, you must set password manuallyhomehgecosgshellsingroupGdisabled-passwordDempty-passwordDsystemSno-create-homeHuidum--e:e--mmissing new password$1$an error occurred updating password for %sPassword for '%s' changedencryptedemd5m?2:P+sP:S:m:a:sha512Password: stdinspassword-fdPsaltSmethodm'%s' still has '%s' as their primary group!/bin/login/etc/issue-2:t+bad speed: %stoo many alternate speedsgetty: %s/dev/%sstdin is not open for read/writetcgetattrinput overruntcsetattrcan't execute '%s'I:LH:f:hil:mt:wnf:h:p-f is for root onlyUNKNOWN on '%s' from '%s'/etc/securetty# Login incorrectinvalid password for '%s'%s/etc/nologin System closed for routine maintenance LOGIN_PRE_SUID_SCRIPTLOGIN_TTYLOGIN_USERLOGIN_UIDLOGIN_GIDLOGIN_SHELL/etc/motdroot login%s Login timed out after %d seconds a:lud%s can't change password for %sno record of %s in %s, using %scan't change locked password for %sChanging password for %s Old password: incorrect password for %sIncorrect passwordNew password: Retype password: Passwords don't matchpassword for %s is unchanged!%scan't update password file %sPassword for %s changed by %spassword for %s is already %slockedmplc:s:none%c %s %s:%sincorrect passwordusing restricted shellnot a ttyGive root password for system maintenance (or type Control-D for normal startup):Normal startuplogin incorrectSystem Maintenance ModeSUSHELLsushellno password entry for root=0/dev/ttyVT_GETMODEVirtual console%s locked by %s. Password incorrect%%llu.%u.%sContent-Type: ;" text/plainmultipart/mixedboundary=header: %sno support of content type '%s'us-asciicharset=7bitContent-Transfer-Encoding:filename=CONTENT_TYPECHARSETENCODING8bitno support of encoding '%s' x--X:X--x:m::x:Xdeis:r:c:m:h:o:O:c:e:o:C:N:a:m:j:%u-%u-%uMime-Version: 1.0 Content-Type: multipart/mixed; boundary="%s" --%s Content-Type: %s; charset=%s Content-Disposition: inline; filename="%s" Content-Transfer-Encoding: base64 --%s-- %s failed: %s-1:dd:t+:R+:L+:H+bdmVcasTkt:R:Z:L:H:M:F:APOP %sUSER %sPASS %sSTATRETR %uTOP %%u %utmp/%llu.%u.%sdelivery helperDELE %uQUITRCPT TO:<%s>Bad recipient: <%s>f:w+:H--S:S--H:a::tf:o:iw:H:S:a::SMTPHOST127.0.0.1NOOPINIT failedEHLO %sHELO %sAUTH LOGINMAIL FROM:<%s>To:Bcc:To: %sDATAUser: no username or passwordhelper killed by signal %uhelper exited (%u)qo:f:p:t: mode: %d -o offset: %ld -f frequency: %ld maxerror: %ld esterror: %ld status: %d ( | ) -p timeconstant: %ld precision: %ld tolerance: %ld -t tick: %ld time.tv_sec: %ld time.tv_usec: %ld return value: %d (%s) f:l:d:r:nKIOCSOUNDvVsSEHANGUPABORTCLR_ABORTTIMEOUTECHOSAYRECORD%s not supported %s min/max priority : %u/%u -1:r--fo:f--ro:r--fo+mprfocan't %cet pid %d's policypid %d's %s scheduling policy: %s can't get pid %d's attributespid %d's %s scheduling priority: %d currentnewIuser %s: parse error at %signoring file '%s' (no such user)user:%s entry:%sMAILTO= command:%sIuser %s: too many linescron.updatechdir(%s)Ican't get uid for %sHOMEIchdir(%s)/var/spool/cronchild running %s-tican't execute '%s' for user %sExec failed: %s -c %s can't vfork/var/spool/cron/crontabsf-b:b-f:S-L:L-S:d-l:l+:d+l:L:fbSc:d:crond (busybox 1.18.3) started, log level %d/var/run/crond.pidwakeup dt=%ldItime disparity of %ld minutes detectedfile %s: line %s job: %d %suser %s: process already running: %s%s/cron.%s.%dTo: %s Subject: cron: %s can't create mail file %s for user %s, discarding outputUSER %s pid %3d cmd %ssendmailjanfebmaraprmayjunjulaugsepoctnovdecsunmontuewedthufrisatVISUALEDITORviexec %s?1:dru:c:lerduser %s cannot read %s%s.%u%s.newcan't create %s/%scan't append to %s/%sstack underflowstack overflowsyntax error at '%s'error, base %u is not supported%g %llx %llo  /dev/memmmapbad width0x%0*llX  bhwl?1:t--T:T--ttTs/dev/cdromnot a sg device or old sg driver/dev/fb0cs:d:i:f:syntax error: %s#=FBIOGET_VSCREENINFOFBIOGET_FSCREENINFOonly 16 bpp is supported[?25lbad PPM file '%s'P6 %u %u %uBAR_WIDTHBAR_HEIGHTBAR_LEFTBAR_TOPBAR_RBAR_GBAR_B %-20s*%cdma%u setting %s to %ld (off) (on) setting %s to %ld %s = %2ld (tristate) (unknown: %d) CompactFlash ATA device, with unknownATAPI %s, with unknown device typenon-%sremovable media powers-up in standby; SET FEATURES subcmd spins-up. WARNING: ID response incomplete. Following data may be incorrect. Model Number:Serial Number:Firmware Revision:Media Serial Num:Media Manufacturer:Standards: Used: %s Supported: Likely used: %u & some of %u Used: ATAPI for CD-ROMs, SFF-8020i, r2.5 Supported: CD-ROM ATAPI-%u Likely used CD-ROM ATAPI-1Configuration:3ms<=10ms with INTRQ50us DRQ response: %s Packet size: 12 bytes16 bytes CHS addressing not supported Logical max current cylinders %u %u heads %u %u sectors/track %u %u -- bytes/track: %u bytes/sector: %u CHS current addressable sectors:%11u LBA user addressable sectors:%11u LBA48 user addressable sectors:%11llu device size with M = 1024*1024: %11llu MBytes device size with M = 1000*1000: %11llu MBytes (%llu GB) Capabilities: Cmd queuing, Cmd overlap, LBA, not(may be)IORDY%s(can%s be disabled) no IORDYdual port, multi-sector with read caching abilitysingle port, single-sector Buffer type: %04x: %s%s Buffer size: %.1fkB bytes avail on r/w long: %u Queue depth: %u Can%s perform double-word IO vendorstandard Standby timer values: spec'd by %swith, %s device specific minimum R/W multiple sector transfer: Max = %u Current = AdvancedPM level: %u (0x%x) unknown setting (0x%04x) Recommended acoustic management value: %u, current value: %u ATA sw reset required Overlap support: %uus to release bus. %uus to clear BSY after SERVICE cmd. DMA: sdma%u (?) Interleaved DMA support Cycle time: min=%uns recommended=%uns PIO: pio%d no flow control=%uns IORDY flow control=%unsCommands/features: Enabled Supported: * %s supported Security: Master password revision code = %u highmaximum Security level %s %umin for %sSECURITY ERASE UNIT. ENHANCED determined by the jumper determined by CSELbelowaboveHW reset results: CBLID- %s Vih Device num = %i%s and required by some commandsenabledCFA power mode 1: %s%s Maximum current = %uma Checksum: %scorrect bad char: '%c' 0x%02x Model=%.40s, FwRev=%.8s, SerialNo=%.20s Config={ } RawCHS=%u/%u/%u, TrkSize=%u, SectSize=%u, ECCbytes=%u BuffType=(%u) %s, BuffSize=%ukB, MaxMultSect=%u, MultSect=?%u? (maybe): CurCHS=%u/%u/%u, CurSects=%lu, LBA=%s, LBAsects=%uon/off IORDY=%s, tPIO={min:%u,w/IORDY:%u}, tDMA={min:%u,rec:%u} PIO modes: pio0 pio1 pio2 DMA modes: UDMA modes: AdvancedPM=%s: disabled (255): unknown setting: mode=0x%02X (%u) WriteCache=%s Drive conforms to: %s: ATA/ATAPI-%u * current active mode BLKFLSBUFHDIO_DRIVE_CMDmlockTiming buffer-cache reads: Timing buffered disk reads:BLKGETSIZE%5u MB in %u.%02u seconds = %u kB/s %s: fs readaheadBLKRASET attempting to unregister hwif#%lu HDIO_UNREGISTER_HWIF attempting to scan hwif (0x%lx, 0x%lx, %lu) HDIO_SCAN_HWIF attempting to auto-tune PIO modeset PIO mode to %d set MDMA mode to %d set UDMA mode to %d HDIO_SET_PIO_MODE32-bit IO_support flagHDIO_SET_32BITmultcountHDIO_SET_MULTCOUNTBLKROSETunmaskirqHDIO_SET_UNMASKINTRusing_dmaHDIO_SET_DMADMA queue_depthHDIO_SET_QDMAnowerrHDIO_SET_NOWERRkeep_settingsHDIO_SET_KEEPSETTINGSdrive doorlockdrive keep featuresdrive defect-mgmtdrive prefetchxfermodedefault PIO modedefault PIO mode, disable IORDYPIO flow control mode%usingleword DMA mode%umultiword DMA mode%uUltraDMA mode%udrive read-lookahead setting APM level to %s 0x%02lX (%ld) drive write-caching issuing standby command issuing sleep command disabling Seagate auto powersaving modestandby%u minutes %u seconds%u.%c hoursvendor-specificreservedHDIO_GET_MULTCOUNTioctl %#x failedHDIO_GET_32BIT IO_support =%3ld (default 16-bit)32-bit)32-bit w/sync)Request-Queue-Bypass)???)HDIO_GET_UNMASKINTRHDIO_GET_DMA (DMA-Assisted-PIO)HDIO_GET_QDMAHDIO_GET_KEEPSETTINGSkeepsettingsHDIO_GET_NOWERRBLKROGETBLKRAGETHDIO_GETGEO geometry = %u/%u/%u, sectors = %ld, start = %ld active/idle drive state is: %s HDIO_DRIVE_RESETHDIO_TRISTATE_HWIF no identification info availableHDIO_GET_IDENTITYbus stateHDIO_SET_BUSSTATEHDIO_GET_BUSSTATEBLKRRPART*sdma0 *sdma1 *sdma2 *sdma? *mdma0 *mdma1 *mdma2 *mdma? *udma3 *udma4 *udma5 *udma6 *udma7 *udma0 *udma1 *udma2 pio3 pio4 pio? gfu::n::p:r::m::c::k::a::B:tTiId::S:D:P:X:K:A:L:W:CyYzZU:Q:wx::b:R:pio0pio1pio2pio3pio4pio5pio6pio7sdma0sdma1sdma2sdma3sdma4sdma5sdma6sdma7mdma0mdma1mdma2mdma3mdma4mdma5mdma6mdma7udma0udma1udma2udma3udma4udma5udma6udma7  !"#$%&'@ABCDEFGDirect-access deviceSequential-access devicePrinterProcessorWrite-once deviceCD-ROMScannerOptical memoryMedium changerCommunications deviceACS-IT8 deviceACS-IT8 deviceArray controllerEnclosure servicesReduced block command deviceOptical card reader/writerUnspecifiedATA-1 X3T9.2 781D prior to rev.4ATA-1 published, ANSI X3.221-1994ATA-1 X3T9.2 781D rev.4ATA-2 published, ANSI X3.279-1996ATA-2 X3T10 948D prior to rev.2kATA-3 X3T10 2008D rev.1ATA-2 X3T10 948D rev.2kATA-3 X3T10 2008D rev.0ATA-2 X3T10 948D rev.3ATA-3 published, ANSI X3.298-199xATA-3 X3T10 2008D rev.6ATA-3 X3T13 2008D rev.7 and 7aATA/ATAPI-4 X3T13 1153D rev.6ATA/ATAPI-4 T13 1153D rev.13ATA/ATAPI-4 X3T13 1153D rev.7ATA/ATAPI-4 T13 1153D rev.18ATA/ATAPI-4 T13 1153D rev.15ATA/ATAPI-4 published, ANSI INCITS 317-1998ATA/ATAPI-5 T13 1321D rev.3ATA/ATAPI-4 T13 1153D rev.14ATA/ATAPI-5 T13 1321D rev.1ATA/ATAPI-5 published, ANSI INCITS 340-2000ATA/ATAPI-4 T13 1153D rev.17ATA/ATAPI-6 T13 1410D rev.0ATA/ATAPI-6 T13 1410D rev.3aATA/ATAPI-7 T13 1532D rev.1ATA/ATAPI-6 T13 1410D rev.2ATA/ATAPI-6 T13 1410D rev.1ATA/ATAPI-7 published, ANSI INCITS 397-2005ATA/ATAPI-7 T13 1532D rev.0reservedreservedATA/ATAPI-7 T13 1532D rev.4aATA/ATAPI-6 published, ANSI INCITS 361-2002reservedreservedhard sectoredsoft sectorednot MFM encoded head switch time > 15usspindle motor control optionfixed driveremovable drivedisk xfer rate <= 5Mbsdisk xfer rate > 5Mbs, <= 10Mbsdisk xfer rate > 5Mbsrotational speed tol.data strobe offset optiontrack offset optionformat speed tolerance gap reqdATAPINOP cmdREAD BUFFER cmdWRITE BUFFER cmdHost Protected Area feature setDEVICE RESET cmdSERVICE interruptRelease interruptLook-aheadWrite cachePACKET command feature setPower Management feature setRemovable Media feature setSecurity Mode feature setSMART feature setFLUSH CACHE EXT cmdMandatory FLUSH CACHE cmd Device Configuration Overlay feature set 48-bit Address feature set SET MAX security extensionAddress Offset Reserved Area BootSET FEATURES subcommand required to spinup after power upPower-Up In Standby feature setRemovable Media Status Notification feature setAdv. Power Management feature setCFA feature setREAD/WRITE DMA QUEUEDDOWNLOAD MICROCODE cmdGeneral Purpose Logging feature setMedia Card Pass Through Command feature set Media serial number SMART self-test SMART error logging supportedenabledlockedfrozenexpired: security countsupported: enhanced eraseHardSectSoftSectNotMFMHdSw>15uSecSpinMotCtlFixedRemoveableDTR<=5MbsDTR>5MbsDTR>10MbsRotSpdTol>.5%dStbOffTrkOffFmtGapReqnonMagneticunknown1SectDualPortDualPortCachen+:c+:p++n:c:p:bad class %dioprio_%cet%s: prio %d - %s(%u+%02u:%02u) stilllogged in- down - crash gone- no logout%-8.8s %-12.12s %-*.*s %-16.16s %-7.7s %s /var/log/wtmpWf:rebootrunlevelsystem boot wtmp begins %s[%u;0H[%u;%uH%s%s (file %i of %i) lines %i-%i/%i (END) - next: %s%i%%%7u %07u %s%.*s%.*s%s%s %s%s%s %s(END)%s (file %i of %i)No previous fileNo next fileNo matches found Examine: Cannot read this fileEMmN~ISmissing filenameMark: Invalid mark letterGo to mark: Mark not setLog file: Error opening log fileDoneNo bracket in top lineNo matching bracket foundNo bracket in bottom line ::%c @ABCDEFGHI@KLMNOPQRSTUVWXYZ[\]^_rootdir=%s table=%40s %c %o %40s %40s %u %u %u %u %uinvalid line %d: '%s'line %d: can't chown %sline %d: can't chmod %sline %d: regular file '%s' does not existline %d: unsupported file type %c%s%uline %d: can't create node %s.so %s/%s.lzmagtbl | nroff -Tlatin1 -mandoc 2>&1 | %sbz2+aw1:2:3:4:5:6:7:8:9/usr/manMANPAGERmore/etc/man.config/etc/man.conf/etc/man_db.confMANDATORY_MANPATHMANSECT%s/%s%.*s/%s.%.*s.lzmano manual entry for '%s'catmancan't tcsetattr for %s=1:s+:d+:t+Xs:d:t:/var/lock/LCK..%scan't create '%s'%4d qdxn%s: not a block device%s/..not %s is %sa mountpoint /dev/tapeunrecognized opcode %sAt block %d bsfbsfmbsrbssdatacompressioneomerasefsffsfmfsrfssloadlockmkpartnopofflinerewofflineras1ras2ras3resetretensionrewindseeksetblksetdensitydrvbuffersetparttellwsetunloadunlockeofweofRAID_AUTORUN%c %c can't write to filebad block ones complunexpected block no, 0x%08x, expecting 0x%08xchecksum error, expected 0x%02x, got 0x%02xcrc error, expected 0x%04x, got 0x%04xtoo many errors; giving upafon:{%s}: %7lo +vpCommand terminated by signal %u Command exited with non-zero status %u %\%uh %um %02us%um %u.%02us%u%%?%%%u.%02ureal %E user %u sys %T Command being timed: "%C" User time (seconds): %U System time (seconds): %S Percent of CPU this job got: %P Elapsed (wall clock) time (h:mm:ss or m:ss): %E Average shared text size (kbytes): %X Average unshared data size (kbytes): %D Average stack size (kbytes): %p Average total size (kbytes): %K Maximum resident set size (kbytes): %M Average resident set size (kbytes): %t Major (requiring I/O) page faults: %F Minor (reclaiming a frame) page faults: %R Voluntary context switches: %w Involuntary context switches: %c Swaps: %W File system inputs: %I File system outputs: %O Socket messages sent: %s Socket messages received: %r Signals delivered: %k Page size (bytes): %Z Exit status: %xreal %e user %U sys %S+s:t:unknown signal '%s'%32.32s Ft:T:WDIOC_SETOPTIONSWDIOC_SETTIMEOUTV/lib/modules%s/%s/%sfdalvpF:0modules.depdescriptionauthorlicensevermagicparmunknown symbol in module or invalid parameterinvalid module formatmodule has wrong symbol versionmodules.dep.bberror in %s at '%s'.koalias=__ksymtab_gplsymbol:depends=modules.dep.bb.newdeleting stale %s%s%s%s %s%s /proc/modules/etc/modules/%smodule '%s' not foundblacklistnaAeF:qruqrfsvw%s "%s"can't read '%s'can't insert '%s': %s/proc/net/arp%s 0x%x 0x%x %s %s %s ether%s (%s) at * %s [%s] netmask %s No match found in %d entries inetaddress family%s: %s not supportedA:p:H:t:i:adnDsv%s: unknown %shardware type%s: kernel only supports 'inet'%s: %s without ARP supportneed host nameneed hardware addresscant get HW-Address for '%s'protocol type mismatchinvalid hardware addressfeature ATF_DONTPUB is not supportedfeature ATF_MAGIC is not supported255.255.255.255SIOCSARPNo ARP entry for %s SIOCDARP(priv)SIOCDARP(pub)pubprivtemptraildontpubautodevnetmaskPERMPUPTRAILSent %u probe(s) (%u broadcast(s)) Received %u repl%s (%u request(s), %u broadcast(s)) eth0interface %s %%s=1:Df:AU:c+DUAqfbc:w:I:s:SIOCGIFFLAGSis not ARPableinvalid source address %ssetsockopt(SO_DONTROUTE)no IP address configuredis not ARPable (no ll address)ARPING to %s from %s via %s recvfromBroadUni%scast re%s from %s [%s]for %s for %u.%03ums UNSOLICITED?SIOCGIFBRbridge name bridge id STP enabled interfacescan't get bridge name for index %dSIOCDEVPRIVATE%s %.2x no yescan't get interface name for index %d %s bridge %siface %stimespec  0offnno1onyyesaddbrdelbraddifdelifstpsetageingsetfdsethellosetmaxagesetpathcostsetportpriosetbridgeprioshowmacsshow0.0.0.0/etc/dnsd.confvsi:c:t:p:derror at line %u, skippingname:%s, ip:%s.%u.%u.%u.%uaccepting UDP packets on %spacket size %d, ignoredgot UDP packetpacket has 0 queries, ignoredresponse packet, ignoredopcode != 0class != 1type is !REQ_A and !REQ_PTRreturning positive replyname is not foundsending error replydropping query%s, %sbi:p:%2x:%2x:%2x:%2x:%2x:%2xcan't read Wake-On-LAN passSIOCGIFHWADDR on %s failedSO_BROADCASTSIOCGIFINDEX425 Use PORT/PASV first ftpd213-File status: Directory listing421 Timeout FILE: uniq.XXXXXX Ok to send datat+:T+:vv:SSvSwt:T:Operation successful Error %s[%u]215 UNIX Type: L8 "-Features: EPSV PASV REST STREAM MDTM SIZE Ok213 %lu 213 %04u%02u%02u%02u%02u%02u 211-Server status: TYPE: BINARY 211 Ok 227 PASV ok (%s,%u,%u) 229 EPSV ok (|||%u|) Opening BINARY connection for %s (%lu bytes)503 Use RNFR first 500 Unknown command unexpected server response%s%s: %scmd %s %s%s %s ftpanonymous-2:vv:cccvu:p:P:Connecting to %s (%s) r+PASSTYPE IPASVREST %luRETRSTORcontinuecverbosevusernameupasswordpportPsethostnamedfisF:vdomaindfqdnffileFhttp:///%s%.*sconfig error '%s' in '%s'closedStatus: %s.gzapplication/octet-streamtext/htmlresponse:%uHTTP/1.0 %d %s Content-type: %s Date: %s Connection: close WWW-Authenticate: Basic realm="%s" Location: %s/%s%s Content-Range: bytes %lu-%lu/%lu Content-length:Transfer-length:Accept-Ranges: bytes Last-Modified: %s %s %lu Content-Encoding: gzip %d %s

%d %s

%s PATH_INFOREQUEST_METHODREQUEST_URI%s=%s?%sSCRIPT_FILENAMESCRIPT_NAMEQUERY_STRINGSERVER_SOFTWARE=busybox httpd/1.18.3SERVER_PROTOCOL=HTTP/1.0GATEWAY_INTERFACE=CGI/1.1REMOTE_ADDRREMOTE_PORTHTTP_USER_AGENTHTTP_ACCEPTHTTP_ACCEPT_LANGUAGECONTENT_LENGTH=%dHTTP_COOKIEREMOTE_USERAUTH_TYPE=BasicHTTP_REFERERHTTP_HOSTconnectedPOSTurl:%sCookie:Referer:User-Agent:Host:Accept:Accept-Language:Authorization:Range:bytes=Accept-Encoding:gzip%s %s%s%s%s HTTP/%c.%c cgi-bin//cgi-bin/index.cgiWeb Server Authenticationvv:ifc:d:h:e:r:m:u:p:ifv&#%d;setgroupsOKPartial ContentRequest TimeoutNo request appeared within 60 secondsNot ImplementedThe requested method is not recognizedUnauthorizedNot FoundThe requested URL was not foundBad RequestUnsupported methodForbiddenInternal Server Errorindex.html/etchttpd.confHTTP/1.0 200 OK HEADGET%a, %d %b %Y %H:%M:%S GMT.txt.h.c.cc.cpptext/plain.htm.htmltext/html.jpg.jpegimage/jpeg.gifimage/gif.pngimage/png.csstext/css.wavaudio/wav.avivideo/x-msvideo.qt.movvideo/quicktime.mpe.mpegvideo/mpeg.mid.midiaudio/midi.mp3audio/mpegbad: '%s'defaultinvalid hw-addr %sSIOCGIFMAPSIOC%sSIOCSIFFLAGSmetricmtutxqueuelendstaddrnetmaskbroadcasthwpointopointkeepaliveoutfillmem_startio_addrtrailerspromiscmulticastallmultidynamicSIFMETRICSIFDSTADDRSIFNETMASKSIFBRDADDRSKEEPALIVESOUTFILLSIFMAPSIFADDRetherinfiniband%s: can't down%s: can't upifenslave%s: SIOCETHTOOL error%s is already a slave%s: can't set address%s: can't clear address%s: can't set MTU%s: can't set hw addresscdfa%s is not a master%s is not up%s is not a slavemaster %s, slave %s: can't change activeskipping %s: can't get flagscan't release %s from %sskipping %s: can't get settingscan't enslave %s to %schange-activecdetachdforcefSIOCDEVPRIVATE+1SIOCGMIIPHYSIOCGMIIREGETHTOOL_GLINKnetlink: recvnetlink packet too small or truncatedgetting interface flagsupping interfacesetting interface flagsusing %s detection modecan't detect link statusSIOCGIWAPexecuting '%s %s %s'IFPLUGD_PREVIOUSIFPLUGD_CURRENTexit code: %d/etc/ifplugd/ifplugd.actiont+:u+:d++ansfFi:r:It:u:d:m:pqlx:Mkifplugd(%s)/var/run/ifplugd.%s.piddaemon already runningunknown API mode '%s'doesn't exist, waitinglink is %spolldisinterface %sappearedSIOCETHTOOLwireless extensionIFF_RUNNINGdownupempwiaifacehwaddressbnmaskip addr flush dev %iface%ip link set %iface% downip addr add 127.0.0.1/8 dev %iface%ip link set %iface% upip link set[[ addr %hwaddress%]] %iface% upudhcpc -R -n -p /var/run/udhcpc.%iface%.pid -i %iface%[[ -H %hostname%]][[ -c %client%]][[ -s %script%]][[ %udhcpc_opts%]]bootpc[[ --bootfile %bootfile%]] --dev %iface%[[ --server %server%]][[ --hwaddr %hwaddr%]] --returniffail --serverbcastip addr add %address%/%bnmask%[[ broadcast %broadcast%]] dev %iface%[[ peer %pointopoint%]][[ label %label%]]ip link set[[ mtu %mtu%]][[ addr %hwaddress%]] %iface% up[[ip route add default via %gateway% dev %iface%]]poff[[ %provider%]]pon[[ %provider%]]start-stop-daemon --stop -x wvdial -p /var/run/wvdial.%iface% -s 2start-stop-daemon --start -x wvdial -p /var/run/wvdial.%iface% -b -m --[[ %provider%]]test -f /var/run/udhcpc.%iface%.pid && kill `cat /var/run/udhcpc.%iface%.pid` 2>/dev/null/var/run/ifstate/etc/network/interfacesanvfmi:mappingtoo few parameters for line "%s"too many parameters "%s"unknown address type "%s"unknown method "%s"duplicate interface "%s"interface declared auto twice "%s"option with empty value "%s"pre-uppost-downduplicate option "%s"duplicate script in mapping "%s"misplaced option "%s"interface %s already configuredinterface %s not configuredRunning mapping script %s on %s don't seem to have all the variables for %s/%signoring unknown interface %sIF_%s=%sIFACEADDRFAMrun-parts /etc/network/if-%s.dmanualwvdialpppstaticbootpdhcploopbackcan't extend file limit, max = %dsetrlimit/var/run/inetd.pid%s: exit status %u%s: exit signal %u%.24s %s/%s: bindparse error on line %u, line is ignored%s: no support for IPv6rpc/no support for rpc servicesinternalunknown internal service %s%s/%s: unknown service%s/%s: unknown host '%s'/etc/inetd.confR+:q+R:feq:non-root must specify config fileaccept (for %s)%s/%s: too many connections, pausing%s: no such %snon-root must run services as himselfstreamdgramrdmseqpacketrawerror: no inet socket availableSIOCGIFCONFcompressedDevice not found%s: error fetching interface information: %sX bytes:%llu (%llu.%u %sB)%s%-9s Link encap:%s HWaddr %s Media:%s(auto) %s addr:%s P-t-P:%s Bcast:%s Mask:%s [NO FLAGS] MTU:%d Metric:%dRX packets:%llu errors:%lu dropped:%lu overruns:%lu frame:%lu compressed:%lu TX packets:%llu errors:%lu dropped:%lu overruns:%lu carrier:%lu collisions:%lu compressed:%lu txqueuelen:%d R TInterrupt:%d Base address:0x%lx Memory:%lx-%lx DMA chan:%x %02X-[NONE SET]%02X:%02X:%02X:%02X:%02X:%02X%n%llu%u%u%u%u%n%n%n%llu%u%u%u%u%u%llu%llu%u%u%u%u%n%n%llu%llu%u%u%u%u%u%llu%llu%u%u%u%u%u%u%llu%llu%u%u%u%u%u%u10base210baseTAUI100baseT100baseTX100baseFXDARPA InternetunspecUNSPECLocal LoopbackEthernetPoint-to-Point ProtocolinfinibandInfiniBandUPBROADCASTDEBUGLOOPBACKPOINTOPOINTNOTRAILERSRUNNINGNOARPPROMISCALLMULTISLAVEMASTERMULTICASTKiMiGiTiaddressrouterlinktunneltunlrule-1:?2mbnphsbad IP address: %suse prefix or netmask, not bothbad netmask: %sNETMASK=%s BROADCAST=%s NETWORK=%s PREFIX=%i can't find hostname for %sHOSTNAME=%s netmaskmbroadcastbnetworknprefixphostnamehsilents%s : USERID : UNIX : %s fiwb:nobodyidentdinterface name '%s' too longbus=driver=mac=can't parse %sno selectors found for %s/etc/mactabsc:can't change ifname %s to %s: NBDMAGICBSlogin failedNBD_SET_SOCK/sys/block/%.32s/pidlp:w:i:f:e:accept%s/cmdlinefdsocket:[[0000]:%s: bogus data on line %dlaentuwxrWpPID/Program name can't scan /proc - are you root?showing only processes with your user IDActive Internet connections (servers and established)(only servers)(w/o servers)Foreign AddressLocal Address Proto Recv-Q Send-Q %-*s %-*s State %s /proc/net/tcp/proc/net/udp/proc/net/rawActive UNIX domain sockets Proto RefCnt Flags Type State I-Node %sPath /proc/net/unix%*p: %lX %lX %lX %X %X %lu %nDGRAMSTREAMRDMSEQPACKETFREELISTENINGCONNECTEDDISCONNECTING[ ACC W N %-5s %-6ld %-11s %-10s %-13s %6lu %*d: %32[0-9A-Fa-f]:%X %32[0-9A-Fa-f]:%X %X %lX:%lX %*X:%*X %*X %d %*d %ld %s %6ld %6ld %-*s %-*s %-12s%.20sESTABLISHEDSYN_SENTSYN_RECVFIN_WAIT1FIN_WAIT2TIME_WAITCLOSECLOSE_WAITLAST_ACKLISTENCLOSING%-10s %s Address %u: %s%ccan't resolve '%s'Server:Name:send failedexecuting '%s %s'stratum%s=%ufreq_drift_ppm%s=%ldpoll_intervaloffset%s=%fdd:p::wnnqNxwp:S:ld46aAbgLmalformed packet received from %s: size %usettimeofday%a %b %e %H:%M:%S %Z %Ysetting clock to %s (offset %fs)stepadjtimexupdate peer:%s, offset:%f, clock drift:%ld ppmrecv(%s) errormalformed packet received from %sreply from %s: not synced, next query in %usreply from %s: reach 0x%02x offset %f delay %f status 0x%02x strat %d refid 0x%08x rootdelay %fsent query to %stimed out waiting for %s, reach 0x%02x, next query in %uspoll %us, sockets:%u, poll interval:%usperiodic --- %s ping statistics --- %lu packets transmitted, %lu packets received, %lu duplicates, %lu%% packet loss round-trip min/avg/max = %u.%03u/%u.%03u/%u.%03u ms =1:q--v:v--q:c+:w+:W+qvc:s:w:W:I:4PING %s (%s): %d data bytes can't set multicast source interface (DUP!)%d bytes from %s: seq=%u ttl=%d time=%u.%03u msEcho ReplyDestination UnreachableSource QuenchRedirect (change route)Echo RequestTime ExceededParameter ProblemTimestamp RequestTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask Replyunknown ICMP typewarning: got ICMP %d (%s)10245000cbp:P:t:T:Scanning %s ports %u to %u Port Proto State Service %5u tcp %s %s %d closed, %d open, %d timed out (or blocked) ports blockedresolving %sgateway %s is a NETWORKnetmask %.8x and host route conflictbogus netmask %snetmask and route address conflictSIOCADDRTSIOCDELRT/proc/net/routeMetric Ref Use MSS Window irttKernel IP routing table Destination Gateway Genmask Flags %s Iface %*[^ ] %63s%lx%lx%X%d%d%d%lx%d%d%d fscanf%-15.15s %-15.15s %-16s%-6s%5d %-5d %6d %s %-6d %-2d %7d %s -net-hostA:neadddeldelete#net#host metric netmaskgw gatewaymss windowirttdev device reject!mod"dyn #reinstateGHRDMset stateTIOCSETDcslipp:s:c:ehmLFprotocolbaud rateget stateTIOCGETDSIOCSIFENCAPslipcslipslip6cslip6adaptivestatus %u/%u%s%s=%s-3:i--i:ph:vv:b+:c++c:C:i:x:u:l:Eb:hpt:vlistening on %s, starting, uid %u, gid %ulistening on %s, startingcan't look up hostname for %sconcurrency %s %u/%ustart %u %s-%sstart %u %s-%s (%s-%s)UDPTCPTCPORIGDSTADDRPROTOLOCALADDRREMOTEADDRLOCALHOSTREMOTEHOSTTCPCONCURRENCYgot signal %u, exit?exitend %d %s %d Entering character mode%s'^]'. Entering line mode%s'^C'. Console escape. Commands are: l go to line mode c go to character mode z suspend telnet e exit telnet continuing... telnetConnection closed by foreign host Escape character is /etc/issue.netwF:w+:i--w:w--if:l:Kip:b:FSw:bad blocksize '%s'